Dpspm.ie Daily Stats | |
---|---|
![]() |
2 |
![]() |
7 |
![]() |
$ 0.02 |
Dpspm.ie Monthly Stats | |
---|---|
![]() |
72 |
![]() |
207 |
![]() |
$ 0.62 |
Dpspm.ie Yearly Stats | |
---|---|
![]() |
889 |
![]() |
2,557 |
![]() |
$ 7.67 |
Dpspm.ie or simply erothots receives roughly 7 pageviews (page impressions) daily from it's 2 unique daily visitor. The creation date of dpspm.ie was not found. and it's hosted on the IP Address 217.115.119.30 in Dublin, Ireland. It has an estimated worth of $ 25.00 and a global Alexa rank of 3,518,513.
Updated 1 week ago
Domain name | Dpspm.ie |
Title |
DPS Property & Facilities Management | DPS Dundalk |
Keywords |
DPS, Duffy Property, Property, Facilities, Property Management, Facilities Management, Dundalk, Property Dundalk, DNG, DNG Dundalk, Rental Property Dundalk, Properties for Rent Dundalk, Commercial Property Rentals, Property Management Dundalk, Property Management Drogheda, Commercial Rentals, Lettings, Real Estate, Estate Management, OMC, Owners Management Company, Block Management, Apartment Management, Lettings Dundalk, Lettings Drogheda, Lettings Navan, Lettings Ardee, Lettings Swords, Lettings Kells, Bounce Design Studios, Bounce Studios, Graphic Design Dundalk, Web Design Dundalk |
Description |
DPS Property & Facilities Management dedicated to managing legal, accounting and maintenance of Block Residential, Commercial and Mixed Use Developments. |
IP Address | 217.115.119.30 |
Country |
Ireland
![]() |
Region | Leinster |
City | Dublin |
Longitude | -6.2712 |
Latitude | 53.3402 |
www.pspm.ie | www.fpspm.ie |
www.dspm.ie | www.cpspm.ie |
www.dppm.ie | www.xpspm.ie |
www.dpsm.ie | www.dospm.ie |
www.dpsp.ie | www.dlspm.ie |
www.ddpspm.ie | www.dpapm.ie |
www.dppspm.ie | www.dpwpm.ie |
www.dpsspm.ie | www.dpepm.ie |
www.dpsppm.ie | www.dpdpm.ie |
www.dpspmm.ie | www.dpxpm.ie |
www.pdspm.ie | www.dpzpm.ie |
www.dsppm.ie | www.dpsom.ie |
www.dppsm.ie | www.dpslm.ie |
www.dpsmp.ie | www.dpspn.ie |
www.spspm.ie | www.dpspj.ie |
www.epspm.ie | www.dpspk.ie |
www.rpspm.ie |
Website | Last Visit |
---|---|
metaltextiles.com | 7 Sec ago |
franklybeing.com | 7 Sec ago |
fayettevillefarmersmarketcny.com | 8 Sec ago |
sasifcri.blogspot.com | 8 Sec ago |
timer.net | 8 Sec ago |